PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G1675
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 200aa    MW: 23021.9 Da    PI: 7.7635
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G1675genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1414.1e-1365122562
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                  ++ +r+++NReAArrsR RK++ ++ L   v +L  eN +   +++  ++ + + ++e
  Gh_A11G1675  65 RKRKRMASNREAARRSRMRKQKHLDDLMGQVSQLAHENNQILANINITTQIYLNIEAE 122
                  5789***********************************9999998877777666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-1561125IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.40463110IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.6E-1163140No hitNo description
PfamPF001704.6E-1065110IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.06E-1265117No hitNo description
CDDcd147022.99E-1866116No hitNo description
PROSITE patternPS0003606883IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MSPVLCEILL SGLMINSTLR RRTHLVQSFS VVFLYWFYVT GSSSSSATRR SSSSVEEFQQ  60
VLNERKRKRM ASNREAARRS RMRKQKHLDD LMGQVSQLAH ENNQILANIN ITTQIYLNIE  120
AENTVLRAQM AELSTRLQSL NEINDFISSN NGVFGYDHPN NYEADHDHHH HQVNIDTFMN  180
NPWGCFYGNQ PIIASADMIM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16485RKRKRMASNREAARRSRMRKQK
27784RRSRMRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.104642e-43boll| leaf| ovule| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00267DAPTransfer from AT2G18160Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012491624.14e-98PREDICTED: ocs element-binding factor 1-like
TrEMBLA0A0D2TI921e-126A0A0D2TI92_G
STRINGVIT_04s0023g02430.t018e-49(Vitis vinifera)
STRINGPOPTR_0004s16560.17e-49(Populus trichocarpa)
STRINGPOPTR_0005s25290.16e-49(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18160.17e-45basic leucine-zipper 2